Lineage for d4iota_ (4iot A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815651Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1815652Protein automated matches [190605] (17 species)
    not a true protein
  7. 1815681Species Escherichia coli [TaxId:316385] [226569] (1 PDB entry)
  8. 1815682Domain d4iota_: 4iot A: [223288]
    automated match to d2vomd_
    complexed with so4

Details for d4iota_

PDB Entry: 4iot (more details), 1.85 Å

PDB Description: High-resolution Structure of Triosephosphate isomerase from E. coli
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4iota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iota_ c.1.1.0 (A:) automated matches {Escherichia coli [TaxId: 316385]}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
afavivkaaeaakq

SCOPe Domain Coordinates for d4iota_:

Click to download the PDB-style file with coordinates for d4iota_.
(The format of our PDB-style files is described here.)

Timeline for d4iota_: