SCOPe 2.05: Domain d4io7b_: 4io7 B:

Lineage for d4io7b_ (4io7 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Adineta vaga [TaxId:104782] [226596] (6 PDB entries)

8. Domain d4io7b_: 4io7 B: [223283]
   automated match to d2a5tb_
   complexed with cl, phe

Details for d4io7b_

PDB Entry: 4io7, 1.92 Å

PDB Description: crystal structure of the avglur1 ligand binding domain complex with phenylalanine at 1.9 angstrom resolution

PDB Compounds: (B:) AvGluR1 ligand binding domain

SCOPe Domain Sequences for d4io7b_:

Sequence, based on SEQRES records:

>d4io7b_ c.94.1.0 (B:) automated matches {Adineta vaga [TaxId: 104782]}
gsarlkgitlrigviesvpftivanvidtsgrnttkltgyvldlieylrdkmgfvadvql
appntsytglvlalangdydiaigditvtsarreivafsnsisdnsmrilmrkgtlidgm
ddlkngkipynrigirigtagedyylreisggsrnfyplksrqemydsllagiidvsfmd
igtaeyvtnniycnltlvgedfdkstfgivtpkewlyakdldvnilslretgildnlkkk
wfqtkacp

Sequence, based on observed residues (ATOM records):

>d4io7b_ c.94.1.0 (B:) automated matches {Adineta vaga [TaxId: 104782]}
gsarlkgitlrigviesvpftivanvidgrnttkltgyvldlieylrdkmgfvadvqlap
pntsytglvlalangdydiaigditvtsarreivafsnsisdnsmrilmrkgtlidgmdd
lkngkipynrigirigtagedyylreisggsrnfyplksrqemydsllagiidvsfmdig
taeyvtnniycnltlvgedfdkstfgivtpkewlyakdldvnilslretgildnlkkkwf
qtkacp

Timeline for d4io7b_:

• d4io7b_ first appeared in SCOPe 2.03
  
• d4io7b_ appears in SCOPe 2.04
  
• d4io7b_ is called d4io7b1 in SCOPe 2.06
  
• d4io7b_ appears in the current release, SCOPe 2.08, called d4io7b1