Lineage for d4io2a1 (4io2 A:3-248)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163432Species Adineta vaga [TaxId:104782] [226596] (6 PDB entries)
  8. 2163433Domain d4io2a1: 4io2 A:3-248 [223272]
    Other proteins in same PDB: d4io2a2, d4io2b2
    automated match to d2a5tb_
    complexed with cl, glu

Details for d4io2a1

PDB Entry: 4io2 (more details), 1.37 Å

PDB Description: crystal structure of the avglur1 ligand binding domain complex with glutamate at 1.37 angstrom resolution
PDB Compounds: (A:) Glutamate receptor 1

SCOPe Domain Sequences for d4io2a1:

Sequence, based on SEQRES records: (download)

>d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}
arlkgitlrigviesvpftivanvidtsgrnttkltgyvldlieylrdkmgfvadvqlap
pntsytglvlalangdydiaigditvtsarreivafsnsisdnsmrilmrkgtlidgmdd
lkngkipynrigirigtagedyylreisggsrnfyplksrqemydsllagiidvsfmdig
taeyvtnniycnltlvgedfdkstfgivtpkewlyakdldvnilslretgildnlkkkwf
qtkacp

Sequence, based on observed residues (ATOM records): (download)

>d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}
arlkgitlrigviesvpftivanvnttkltgyvldlieylrdkmgfvadvqlappntsyt
glvlalangdydiaigditvtsarreivafsnsisdnsmrilmrkgtlidgmddlkngki
pynrigirigtagedyylreisggsrnfyplksrqemydsllagiidvsfmdigtaeyvt
nniycnltlvgedfdkstfgivtpkewlyakdldvnilslretgildnlkkkwfqtkacp

SCOPe Domain Coordinates for d4io2a1:

Click to download the PDB-style file with coordinates for d4io2a1.
(The format of our PDB-style files is described here.)

Timeline for d4io2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4io2a2