Lineage for d4io2a_ (4io2 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1391680Species Adineta vaga [TaxId:104782] [226596] (6 PDB entries)
  8. 1391681Domain d4io2a_: 4io2 A: [223272]
    automated match to d2a5tb_
    complexed with cl, glu

Details for d4io2a_

PDB Entry: 4io2 (more details), 1.37 Å

PDB Description: crystal structure of the avglur1 ligand binding domain complex with glutamate at 1.37 angstrom resolution
PDB Compounds: (A:) Glutamate receptor 1

SCOPe Domain Sequences for d4io2a_:

Sequence, based on SEQRES records: (download)

>d4io2a_ c.94.1.0 (A:) automated matches {Adineta vaga [TaxId: 104782]}
gsarlkgitlrigviesvpftivanvidtsgrnttkltgyvldlieylrdkmgfvadvql
appntsytglvlalangdydiaigditvtsarreivafsnsisdnsmrilmrkgtlidgm
ddlkngkipynrigirigtagedyylreisggsrnfyplksrqemydsllagiidvsfmd
igtaeyvtnniycnltlvgedfdkstfgivtpkewlyakdldvnilslretgildnlkkk
wfqtkacp

Sequence, based on observed residues (ATOM records): (download)

>d4io2a_ c.94.1.0 (A:) automated matches {Adineta vaga [TaxId: 104782]}
gsarlkgitlrigviesvpftivanvnttkltgyvldlieylrdkmgfvadvqlappnts
ytglvlalangdydiaigditvtsarreivafsnsisdnsmrilmrkgtlidgmddlkng
kipynrigirigtagedyylreisggsrnfyplksrqemydsllagiidvsfmdigtaey
vtnniycnltlvgedfdkstfgivtpkewlyakdldvnilslretgildnlkkkwfqtka
cp

SCOPe Domain Coordinates for d4io2a_:

Click to download the PDB-style file with coordinates for d4io2a_.
(The format of our PDB-style files is described here.)

Timeline for d4io2a_: