Lineage for d1qung1 (1qun G:1-121)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 55228Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 55229Family b.1.11.1: Pilus chaperone [49355] (2 proteins)
  6. 55230Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 55231Species Escherichia coli [TaxId:562] [49359] (2 PDB entries)
  8. 55235Domain d1qung1: 1qun G:1-121 [22327]
    Other proteins in same PDB: d1quna2, d1qunb1, d1qunb2, d1qunc2, d1qund1, d1qund2, d1qune2, d1qunf1, d1qunf2, d1qung2, d1qunh1, d1qunh2, d1quni2, d1qunj1, d1qunj2, d1qunk2, d1qunl1, d1qunl2, d1qunm2, d1qunn1, d1qunn2, d1quno2, d1qunp1, d1qunp2

Details for d1qung1

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

SCOP Domain Sequences for d1qung1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qung1 b.1.11.1 (G:1-121) Periplasmic chaperone FimC {Escherichia coli}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1qung1:

Click to download the PDB-style file with coordinates for d1qung1.
(The format of our PDB-style files is described here.)

Timeline for d1qung1: