Lineage for d4inba_ (4inb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717877Domain d4inba_: 4inb A: [223269]
    automated match to d1m9cc_
    complexed with 1f6, na

Details for d4inba_

PDB Entry: 4inb (more details), 1.8 Å

PDB Description: Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With benzodiazepine Inhibitor
PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4inba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inba_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d4inba_:

Click to download the PDB-style file with coordinates for d4inba_.
(The format of our PDB-style files is described here.)

Timeline for d4inba_: