SCOPe 2.07: Domain d4imra1: 4imr A:1-253

Lineage for d4imra1 (4imr A:1-253)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Agrobacterium fabrum [TaxId:176299] [226548] (2 PDB entries)

8. Domain d4imra1: 4imr A:1-253 [223257]
   Other proteins in same PDB: d4imra2
   automated match to d3awda_
   complexed with nap, unl

Details for d4imra1

PDB Entry: 4imr, 1.96 Å

PDB Description: crystal structure of 3-oxoacyl (acyl-carrier-protein) reductase (target efi-506442) from agrobacterium tumefaciens c58 with nadp bound

PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d4imra1:

Sequence; same for both SEQRES and ATOM records:

>d4imra1 c.2.1.0 (A:1-253) automated matches {Agrobacterium fabrum [TaxId: 176299]}
mrletifglrgrtalvtgssrgigaaiaeglagagahvilhgvkpgstaavqqriiasgg
taqelagdlseagagtdlieraeaiapvdilvinasaqinatlsaltpndlafqlavnlg
stvdmlqsalpkmvarkwgrvvsigsinqlrpksvvtayaatkaaqhnliqsqardfagd
nvllntlapglvdtdrnadrraqdpegwdeyvrtlnwmgragrpeemvgaalflaseacs
fmtgetifltggy

Timeline for d4imra1:

• d4imra1 first appeared in SCOPe 2.03, called d4imra_
  
• d4imra1 appears in SCOPe 2.06
  
• d4imra1 appears in the current release, SCOPe 2.08