Lineage for d4imkd2 (4imk D:110-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765545Domain d4imkd2: 4imk D:110-212 [223255]
    automated match to d1mcww2
    complexed with gol, na, so4

Details for d4imkd2

PDB Entry: 4imk (more details), 2.2 Å

PDB Description: Uncrossed Fab binding to human Angiopoietin 2
PDB Compounds: (D:) light chain

SCOPe Domain Sequences for d4imkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4imkd2 b.1.1.0 (D:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4imkd2:

Click to download the PDB-style file with coordinates for d4imkd2.
(The format of our PDB-style files is described here.)

Timeline for d4imkd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4imkd1