SCOPe 2.08: Domain d4imkc2: 4imk C:110-215

Lineage for d4imkc2 (4imk C:110-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4imkc2: 4imk C:110-215 [223253]
   automated match to d1mcww2
   complexed with gol, na, so4

Details for d4imkc2

PDB Entry: 4imk, 2.2 Å

PDB Description: Uncrossed Fab binding to human Angiopoietin 2

PDB Compounds: (C:) light chain

SCOPe Domain Sequences for d4imkc2:

Sequence; same for both SEQRES and ATOM records:

>d4imkc2 b.1.1.0 (C:110-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4imkc2:

• d4imkc2 first appeared in SCOPe 2.03
  
• d4imkc2 appears in SCOPe 2.07