![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Escherichia coli [TaxId:199310] [226566] (1 PDB entry) |
![]() | Domain d4im7a2: 4im7 A:281-487 [223251] Other proteins in same PDB: d4im7a1 automated match to d1lj8a3 complexed with cs2, nai, so4 |
PDB Entry: 4im7 (more details), 1.9 Å
SCOPe Domain Sequences for d4im7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4im7a2 a.100.1.0 (A:281-487) automated matches {Escherichia coli [TaxId: 199310]} dvlpyeemklrmlngshsflaylgylagyqhindcmedehyrhaaytlmlqeqaptlkvq gvdlqdyanrlierysnpalrhrtwqiamdgsqklpqrmldsvrwhlahdskfdllalgv agwmryvggvdeqgnpieisdpllpviqkavqssaegtarvqsllaikaifgddlpgnsl fttkvteaylsllahgakatvakysvk
Timeline for d4im7a2: