Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Escherichia coli [TaxId:199310] [226553] (3 PDB entries) |
Domain d4im7a1: 4im7 A:5-280 [223250] Other proteins in same PDB: d4im7a2 automated match to d1lj8a4 complexed with cs2, nai, so4 |
PDB Entry: 4im7 (more details), 1.9 Å
SCOPe Domain Sequences for d4im7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4im7a1 c.2.1.0 (A:5-280) automated matches {Escherichia coli [TaxId: 199310]} hllsakatlpvydrnnlaprivhlgfgafhrahqgvyadilatehfsdwgyyevnligge qqiadlqqqdnlytvaemsadawtarvvgvvkkalhvqidgletvlaamcepqiaivslt itekgyfhspatgqlmldhpmvvadvqnphqpktatgvivealarrkaaglpaftvmscd nmpenghvmrdvvtsyaqaidvklaqwiednvtfpstmvdrivpavtedtlakieqltgv rdaagvacepfrqwviednfvagrpewekagaelvs
Timeline for d4im7a1: