SCOPe 2.05: Domain d4im7a1: 4im7 A:5-280

Lineage for d4im7a1 (4im7 A:5-280)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Escherichia coli [TaxId:199310] [226553] (3 PDB entries)

8. Domain d4im7a1: 4im7 A:5-280 [223250]
   Other proteins in same PDB: d4im7a2
   automated match to d1lj8a4
   complexed with cs2, nai, so4

Details for d4im7a1

PDB Entry: 4im7, 1.9 Å

PDB Description: crystal structure of fructuronate reductase (ydfi) from e. coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate

PDB Compounds: (A:) Hypothetical oxidoreductase ydfI

SCOPe Domain Sequences for d4im7a1:

Sequence; same for both SEQRES and ATOM records:

>d4im7a1 c.2.1.0 (A:5-280) automated matches {Escherichia coli [TaxId: 199310]}
hllsakatlpvydrnnlaprivhlgfgafhrahqgvyadilatehfsdwgyyevnligge
qqiadlqqqdnlytvaemsadawtarvvgvvkkalhvqidgletvlaamcepqiaivslt
itekgyfhspatgqlmldhpmvvadvqnphqpktatgvivealarrkaaglpaftvmscd
nmpenghvmrdvvtsyaqaidvklaqwiednvtfpstmvdrivpavtedtlakieqltgv
rdaagvacepfrqwviednfvagrpewekagaelvs

Timeline for d4im7a1:

• d4im7a1 first appeared in SCOPe 2.03
  
• d4im7a1 appears in SCOPe 2.04
  
• d4im7a1 appears in SCOPe 2.06
  
• d4im7a1 appears in the current release, SCOPe 2.08