SCOPe 2.06: Domain d4ilha1: 4ilh A:1836-2087

Lineage for d4ilha1 (4ilh A:1836-2087)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins)
   automatically mapped to Pfam PF12134

6. Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
   Uniprot P33334 1833-2087! Uniprot P33334 1835-2087

8. Domain d4ilha1: 4ilh A:1836-2087 [223247]
   Other proteins in same PDB: d4ilha2
   automated match to d4ilgb_
   mutant

Details for d4ilha1

PDB Entry: 4ilh, 1.85 Å

PDB Description: Crystal structure of an Aar2p C-terminal deletion mutant in conplex with Prp8p RNaseH

PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4ilha1:

Sequence; same for both SEQRES and ATOM records:

>d4ilha1 c.55.3.14 (A:1836-2087) Pre-mRNA-splicing factor 8, Prp8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisalt
qteikdiilgqn

Timeline for d4ilha1:

• d4ilha1 first appeared in SCOPe 2.03, called d4ilha_
  
• d4ilha1 was called d4ilha_ in SCOPe 2.05
  
• d4ilha1 appears in SCOPe 2.07
  
• d4ilha1 appears in the current release, SCOPe 2.08