Lineage for d1quna1 (1qun A:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764597Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2764615Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 2764616Species Escherichia coli [TaxId:562] [49359] (11 PDB entries)
  8. 2764625Domain d1quna1: 1qun A:1-121 [22324]
    Other proteins in same PDB: d1quna2, d1qunb1, d1qunb2, d1qunc2, d1qund1, d1qund2, d1qune2, d1qunf1, d1qunf2, d1qung2, d1qunh1, d1qunh2, d1quni2, d1qunj1, d1qunj2, d1qunk2, d1qunl1, d1qunl2, d1qunm2, d1qunn1, d1qunn2, d1quno2, d1qunp1, d1qunp2

Details for d1quna1

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli
PDB Compounds: (A:) papd-like chaperone fimc

SCOPe Domain Sequences for d1quna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quna1 b.1.11.1 (A:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d1quna1:

Click to download the PDB-style file with coordinates for d1quna1.
(The format of our PDB-style files is described here.)

Timeline for d1quna1: