SCOPe 2.06: Domain d4ikha1: 4ikh A:5-103

Lineage for d4ikha1 (4ikh A:5-103)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Pseudomonas protegens [TaxId:220664] [226562] (1 PDB entry)

8. Domain d4ikha1: 4ikh A:5-103 [223236]
   Other proteins in same PDB: d4ikha2
   automated match to d1k0db2
   complexed with cl, gsh

Details for d4ikha1

PDB Entry: 4ikh, 2.1 Å

PDB Description: crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4ikha1:

Sequence; same for both SEQRES and ATOM records:

>d4ikha1 c.47.1.0 (A:5-103) automated matches {Pseudomonas protegens [TaxId: 220664]}
safavtqkwpaqfpewiqlyslptpngvkvsimleeiglpyeahrvsfetqdqmtpefls
vspnnkipaildphgpgdqplalfesgailiyladksgq

Timeline for d4ikha1:

• d4ikha1 first appeared in SCOPe 2.03
  
• d4ikha1 appears in SCOPe 2.05
  
• d4ikha1 appears in SCOPe 2.07
  
• d4ikha1 appears in the current release, SCOPe 2.08