Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Pseudomonas protegens [TaxId:220664] [226562] (1 PDB entry) |
Domain d4ikha1: 4ikh A:5-103 [223236] Other proteins in same PDB: d4ikha2 automated match to d1k0db2 complexed with cl, gsh |
PDB Entry: 4ikh (more details), 2.1 Å
SCOPe Domain Sequences for d4ikha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ikha1 c.47.1.0 (A:5-103) automated matches {Pseudomonas protegens [TaxId: 220664]} safavtqkwpaqfpewiqlyslptpngvkvsimleeiglpyeahrvsfetqdqmtpefls vspnnkipaildphgpgdqplalfesgailiyladksgq
Timeline for d4ikha1: