Lineage for d3dpa_1 (3dpa 1-124)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.11: PapD-like [49354] (2 families) 
contains PP switch between strands D and C'Family b.1.11.1: Pilus chaperone [49355] (4 proteins) 
Protein Pilus chaperone PapD, N-domain [49356] (1 species)
consists of two domains of this fold; domain 2 has an additional strand at the C-terminusSpecies Escherichia coli [TaxId:562] [49357] (5 PDB entries) 
Domain d3dpa_1: 3dpa 1-124 [22323]
Other proteins in same PDB: d3dpa_2
CA-atoms only
Details for d3dpa_1
PDB Entry: 3dpa (more details), 2.5 Å
PDB Description: crystal structure of chaperone protein papd reveals an immunoglobulin fold
SCOP Domain Sequences for d3dpa_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dpa_1 b.1.11.1 (1-124) Pilus chaperone PapD, N-domain {Escherichia coli}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp
SCOP Domain Coordinates for d3dpa_1:
Click to download the PDB-style file with coordinates for d3dpa_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dpa_1:
- d3dpa_1 first appeared (with stable ids) in SCOP 1.55
- d3dpa_1 appears in SCOP 1.69
- d3dpa_1 is called d3dpaa1 in SCOP 1.73
- d3dpa_1 appears in the current release, SCOPe 2.08, called d3dpaa1
View in 3D
