Lineage for d4ijnb1 (4ijn B:2-178)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858850Species Mycobacterium smegmatis [TaxId:246196] [226561] (1 PDB entry)
  8. 1858853Domain d4ijnb1: 4ijn B:2-178 [223229]
    automated match to d1g99a1
    complexed with amp, edo, so4

Details for d4ijnb1

PDB Entry: 4ijn (more details), 1.7 Å

PDB Description: crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d4ijnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ijnb1 c.55.1.0 (B:2-178) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
vtvlvvnsgssslkyavvrpasgefladgiieeigsgavpdhdaalraafdelaaaglhl
edldlkavghrmvhggktfykpsvvddeliakarelsplaplhnppaikgievarkllpd
lphiavfdtaffhdlpapastyaidrelaetwhikrygfhgtsheyvsqqaaifldr

SCOPe Domain Coordinates for d4ijnb1:

Click to download the PDB-style file with coordinates for d4ijnb1.
(The format of our PDB-style files is described here.)

Timeline for d4ijnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ijnb2