![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [226561] (1 PDB entry) |
![]() | Domain d4ijnb1: 4ijn B:2-178 [223229] automated match to d1g99a1 complexed with amp, edo, so4 |
PDB Entry: 4ijn (more details), 1.7 Å
SCOPe Domain Sequences for d4ijnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijnb1 c.55.1.0 (B:2-178) automated matches {Mycobacterium smegmatis [TaxId: 246196]} vtvlvvnsgssslkyavvrpasgefladgiieeigsgavpdhdaalraafdelaaaglhl edldlkavghrmvhggktfykpsvvddeliakarelsplaplhnppaikgievarkllpd lphiavfdtaffhdlpapastyaidrelaetwhikrygfhgtsheyvsqqaaifldr
Timeline for d4ijnb1: