| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
| Protein automated matches [190206] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries) |
| Domain d4ijla1: 4ijl A:1-120 [223226] Other proteins in same PDB: d4ijla2 automated match to d2b3ga_ protein/DNA complex; complexed with 1ek |
PDB Entry: 4ijl (more details), 1.7 Å
SCOPe Domain Sequences for d4ijla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijla1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne
Timeline for d4ijla1: