Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (7 species) not a true protein |
Species Hydrogenobacter thermophilus [TaxId:608538] [226622] (2 PDB entries) |
Domain d4ij5a_: 4ij5 A: [223217] automated match to d3d8ha_ complexed with cl, edo |
PDB Entry: 4ij5 (more details), 1.5 Å
SCOPe Domain Sequences for d4ij5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ij5a_ c.60.1.0 (A:) automated matches {Hydrogenobacter thermophilus [TaxId: 608538]} mvklilvrhaesewnpvgryqglldpdlsergkkqakllaqelsrehldviyssplkrty ltaleiaeaknlevikedriieidhgmwsgmlveevmekypedfrrwveephkvefqgge slasvynrvkgfleevrkrhwnqtvvvvshtvpmramycallgvdlskfwsfgcdnasys vihmeerrnvilklnitchlgefyveahkai
Timeline for d4ij5a_: