SCOPe 2.03: Domain d4ij5a_: 4ij5 A:

Lineage for d4ij5a_ (4ij5 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (7 species)
   not a true protein

7. Species Hydrogenobacter thermophilus [TaxId:608538] [226622] (2 PDB entries)

8. Domain d4ij5a_: 4ij5 A: [223217]
   automated match to d3d8ha_
   complexed with cl, edo

Details for d4ij5a_

PDB Entry: 4ij5, 1.5 Å

PDB Description: Crystal Structure of a Novel-type Phosphoserine Phosphatase from Hydrogenobacter thermophilus TK-6

PDB Compounds: (A:) Phosphoserine phosphatase 1

SCOPe Domain Sequences for d4ij5a_:

Sequence; same for both SEQRES and ATOM records:

>d4ij5a_ c.60.1.0 (A:) automated matches {Hydrogenobacter thermophilus [TaxId: 608538]}
mvklilvrhaesewnpvgryqglldpdlsergkkqakllaqelsrehldviyssplkrty
ltaleiaeaknlevikedriieidhgmwsgmlveevmekypedfrrwveephkvefqgge
slasvynrvkgfleevrkrhwnqtvvvvshtvpmramycallgvdlskfwsfgcdnasys
vihmeerrnvilklnitchlgefyveahkai

Timeline for d4ij5a_:

• d4ij5a_ is new in SCOPe 2.03-stable
  
• d4ij5a_ appears in SCOPe 2.04
  
• d4ij5a_ appears in the current release, SCOPe 2.08