SCOPe 2.08: Domain d4iiqb1: 4iiq B:2-116

Lineage for d4iiqb1 (4iiq B:2-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4iiqb1: 4iiq B:2-116 [223205]
   Other proteins in same PDB: d4iiqa2, d4iiqb2, d4iiqc2
   automated match to d1ktke1
   complexed with so4

Details for d4iiqb1

PDB Entry: 4iiq, 2.86 Å

PDB Description: crystal structure of a human mait tcr in complex with bovine mr1

PDB Compounds: (B:) Human Mucosal Associated Invariant T cell receptor beta chain

SCOPe Domain Sequences for d4iiqb1:

Sequence; same for both SEQRES and ATOM records:

>d4iiqb1 b.1.1.0 (B:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4iiqb1:

• d4iiqb1 first appeared in SCOPe 2.03
  
• d4iiqb1 appears in SCOPe 2.07