Lineage for d4iiqa2 (4iiq A:111-201)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752089Domain d4iiqa2: 4iiq A:111-201 [223204]
    Other proteins in same PDB: d4iiqa1, d4iiqb1, d4iiqc1, d4iiqc2, d4iiqc3
    automated match to d2esvd2
    complexed with so4

Details for d4iiqa2

PDB Entry: 4iiq (more details), 2.86 Å

PDB Description: crystal structure of a human mait tcr in complex with bovine mr1
PDB Compounds: (A:) Human Mucosal Associated Invariant T cell receptor alpha chain

SCOPe Domain Sequences for d4iiqa2:

Sequence, based on SEQRES records: (download)

>d4iiqa2 b.1.1.2 (A:111-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d4iiqa2 b.1.1.2 (A:111-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmmdfksnsav
awsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d4iiqa2:

Click to download the PDB-style file with coordinates for d4iiqa2.
(The format of our PDB-style files is described here.)

Timeline for d4iiqa2: