Lineage for d4iind1 (4iin D:1-247)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (244 species)
    not a true protein
  7. 2431312Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries)
  8. 2431332Domain d4iind1: 4iin D:1-247 [223202]
    Other proteins in same PDB: d4iina2, d4iinb2, d4iinc2, d4iind2
    automated match to d1ybva_
    complexed with act, k, nad

Details for d4iind1

PDB Entry: 4iin (more details), 2.4 Å

PDB Description: crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with nad+
PDB Compounds: (D:) 3-ketoacyl-acyl carrier protein reductase (FabG)

SCOPe Domain Sequences for d4iind1:

Sequence, based on SEQRES records: (download)

>d4iind1 c.2.1.0 (D:1-247) automated matches {Helicobacter pylori [TaxId: 85962]}
mqftgknvlitgaskgigaeiaktlasmglkvwinyrsnaevadalkneleekgykaavi
kfdaasesdfieaiqtivqsdgglsylvnnagvvrdklaikmktedfhhvidnnltsafi
gcrealkvmsksrfgsvvnvasiigergnmgqtnysaskggmiamsksfayegalrnirf
nsvtpgfietdmnanlkdelkadyvkniplnrlgsakevaeavafllsdhssyitgetlk
vngglym

Sequence, based on observed residues (ATOM records): (download)

>d4iind1 c.2.1.0 (D:1-247) automated matches {Helicobacter pylori [TaxId: 85962]}
mqftgknvlitgaskgigaeiaktlasmglkvwinyrsnaevadalkneleekgykaavi
kfdaasesdfieaiqtivqsdgglsylvnnagvvrdklaikmktedfhhvidnnltsafi
gcrealkvmsksrfgsvvnvasiigergnmgqtnysaskggmiamsksfayegalrnirf
nsvtpgfietdyvkniplnrlgsakevaeavafllsdhssyitgetlkvngglym

SCOPe Domain Coordinates for d4iind1:

Click to download the PDB-style file with coordinates for d4iind1.
(The format of our PDB-style files is described here.)

Timeline for d4iind1: