![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (2 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
![]() | Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
![]() | Species Escherichia coli [TaxId:562] [49357] (9 PDB entries) |
![]() | Domain d1qppa1: 1qpp A:1-124 [22320] Other proteins in same PDB: d1qppa2, d1qppb2 |
PDB Entry: 1qpp (more details), 2.6 Å
SCOP Domain Sequences for d1qppa1:
Sequence, based on SEQRES records: (download)
>d1qppa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtaavfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
>d1qppa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtaavfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld pgaksmvrlsttpdisklpqdreslfyfnlreipprqialqtkiklfyrpaaiktrp
Timeline for d1qppa1: