Lineage for d1qppa1 (1qpp A:1-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788734Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 788735Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 788784Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 788785Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)
  8. 788792Domain d1qppa1: 1qpp A:1-124 [22320]
    Other proteins in same PDB: d1qppa2, d1qppb2

Details for d1qppa1

PDB Entry: 1qpp (more details), 2.6 Å

PDB Description: crystal structures of self capping papd chaperone homodimers
PDB Compounds: (A:) papd chaperone

SCOP Domain Sequences for d1qppa1:

Sequence, based on SEQRES records: (download)

>d1qppa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtaavfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Sequence, based on observed residues (ATOM records): (download)

>d1qppa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtaavfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprqialqtkiklfyrpaaiktrp

SCOP Domain Coordinates for d1qppa1:

Click to download the PDB-style file with coordinates for d1qppa1.
(The format of our PDB-style files is described here.)

Timeline for d1qppa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qppa2