![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
![]() | Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
![]() | Species Escherichia coli [TaxId:562] [49357] (15 PDB entries) |
![]() | Domain d1qpxb1: 1qpx B:7-124 [22319] Other proteins in same PDB: d1qpxa2, d1qpxb2 |
PDB Entry: 1qpx (more details), 2.4 Å
SCOPe Domain Sequences for d1qpxb1:
Sequence, based on SEQRES records: (download)
>d1qpxb1 b.1.11.1 (B:7-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} travfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrldpgaksm vrlsttpdisklpqdreslfyfnlreipprsekanvvqialctkiklfyrpaaiktrp
>d1qpxb1 b.1.11.1 (B:7-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} travfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrldpgaksm vrlsttpdisklpqdreslfyfnlreippvqialctkiklfyrpaaiktrp
Timeline for d1qpxb1: