Lineage for d4ii5d1 (4ii5 D:175-309)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1274277Protein automated matches [227027] (3 species)
    not a true protein
  7. 1274308Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries)
  8. 1274315Domain d4ii5d1: 4ii5 D:175-309 [223188]
    Other proteins in same PDB: d4ii5a_, d4ii5c_
    automated match to d1finb1
    complexed with adp, gol, mg

Details for d4ii5d1

PDB Entry: 4ii5 (more details), 2.15 Å

PDB Description: structure of pcdk2/cyclina bound to adp and 1 magnesium ion
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4ii5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ii5d1 a.74.1.1 (D:175-309) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpdyqedihtylremevkckpkvgymkrqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyskkqvlrm
ehlvlkvlafdlaap

SCOPe Domain Coordinates for d4ii5d1:

Click to download the PDB-style file with coordinates for d4ii5d1.
(The format of our PDB-style files is described here.)

Timeline for d4ii5d1: