| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries) |
| Domain d4ii5b1: 4ii5 B:175-309 [223185] Other proteins in same PDB: d4ii5a_, d4ii5c_ automated match to d1finb1 complexed with adp, gol, mg |
PDB Entry: 4ii5 (more details), 2.15 Å
SCOPe Domain Sequences for d4ii5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ii5b1 a.74.1.1 (B:175-309) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpdyqedihtylremevkckpkvgymkrqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyskkqvlrm
ehlvlkvlafdlaap
Timeline for d4ii5b1:
View in 3DDomains from other chains: (mouse over for more information) d4ii5a_, d4ii5c_, d4ii5d1, d4ii5d2 |