Lineage for d4ii3d_ (4ii3 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932678Species Schizosaccharomyces pombe [TaxId:284812] [196615] (2 PDB entries)
  8. 2932681Domain d4ii3d_: 4ii3 D: [223183]
    automated match to d3dbhi_
    complexed with atp, ca, mg

Details for d4ii3d_

PDB Entry: 4ii3 (more details), 2.9 Å

PDB Description: crystal structure of s. pombe ubiquitin activating enzyme 1 (uba1) in complex with ubiquitin and atp/mg
PDB Compounds: (D:) ubiquitin-60s ribosomal protein l40

SCOPe Domain Sequences for d4ii3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ii3d_ d.15.1.1 (D:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d4ii3d_:

Click to download the PDB-style file with coordinates for d4ii3d_.
(The format of our PDB-style files is described here.)

Timeline for d4ii3d_: