![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [196615] (2 PDB entries) |
![]() | Domain d4ii3b_: 4ii3 B: [223182] automated match to d3dbhi_ complexed with atp, ca, mg |
PDB Entry: 4ii3 (more details), 2.9 Å
SCOPe Domain Sequences for d4ii3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ii3b_ d.15.1.1 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d4ii3b_: