Lineage for d1qpxa1 (1qpx A:1-124)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361425Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2361426Family b.1.11.1: Pilus chaperone [49355] (6 protein domains)
    automatically mapped to Pfam PF00345
  6. 2361485Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 2361486Species Escherichia coli [TaxId:562] [49357] (15 PDB entries)
  8. 2361491Domain d1qpxa1: 1qpx A:1-124 [22318]
    Other proteins in same PDB: d1qpxa2, d1qpxb2

Details for d1qpxa1

PDB Entry: 1qpx (more details), 2.4 Å

PDB Description: crystal structures of self-capping papd chaperone homodimers
PDB Compounds: (A:) papd chaperone

SCOPe Domain Sequences for d1qpxa1:

Sequence, based on SEQRES records: (download)

>d1qpxa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvvqialctkiklfyrpaai
ktrp

Sequence, based on observed residues (ATOM records): (download)

>d1qpxa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
pgaksmvrlsttpdisklpqdreslfyfnlreippialctkiklfyrpaaiktrp

SCOPe Domain Coordinates for d1qpxa1:

Click to download the PDB-style file with coordinates for d1qpxa1.
(The format of our PDB-style files is described here.)

Timeline for d1qpxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qpxa2