SCOP 1.55: Domain d1e42b1: 1e42 B:705-824

Lineage for d1e42b1 (1e42 B:705-824)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (1 family)

5. Family b.1.10.1: Clathrin adaptor appendage domain [49349] (2 proteins)

6. Protein Beta2-adaptin AP2, N-terminal subdomain [49352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49353] (1 PDB entry)

8. Domain d1e42b1: 1e42 B:705-824 [22317]
   Other proteins in same PDB: d1e42a2, d1e42b2

Details for d1e42b1

PDB Entry: 1e42, 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2

SCOP Domain Sequences for d1e42b1:

Sequence; same for both SEQRES and ATOM records:

>d1e42b1 b.1.10.1 (B:705-824) Beta2-adaptin AP2, N-terminal subdomain {Human (Homo sapiens)}
ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv

Timeline for d1e42b1:

• d1e42b1 appears in SCOP 1.57
  
• d1e42b1 appears in the current release, SCOPe 2.08