Lineage for d4igta_ (4igt A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1390578Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1390788Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 1390797Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (115 PDB entries)
  8. 1390798Domain d4igta_: 4igt A: [223169]
    automated match to d1wvja_
    complexed with 3za, gol, li, so4

Details for d4igta_

PDB Entry: 4igt (more details), 1.24 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with the agonist za302 at 1.24a resolution
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d4igta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4igta_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
lneqglldklknkwwydkgecgs

SCOPe Domain Coordinates for d4igta_:

Click to download the PDB-style file with coordinates for d4igta_.
(The format of our PDB-style files is described here.)

Timeline for d4igta_: