Lineage for d4igjb1 (4igj B:-2-85)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370172Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries)
  8. 1370176Domain d4igjb1: 4igj B:-2-85 [223167]
    Other proteins in same PDB: d4igja2, d4igjb2
    automated match to d1e6ba2
    complexed with so4

Details for d4igjb1

PDB Entry: 4igj (more details), 1.48 Å

PDB Description: Crystal structure of Maleylacetoacetate isomerase from Anaeromyxobacter dehalogenans 2CP-1, target EFI-507175
PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4igjb1:

Sequence, based on SEQRES records: (download)

>d4igjb1 c.47.1.0 (B:-2-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
fqsmtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvl
eveedgrthllvqsmailewleerhpep

Sequence, based on observed residues (ATOM records): (download)

>d4igjb1 c.47.1.0 (B:-2-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
fqsmtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqqvpvleveedg
rthllvqsmailewleerhpep

SCOPe Domain Coordinates for d4igjb1:

Click to download the PDB-style file with coordinates for d4igjb1.
(The format of our PDB-style files is described here.)

Timeline for d4igjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4igjb2