SCOPe 2.08: Domain d4igjb1: 4igj B:1-85

Lineage for d4igjb1 (4igj B:1-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries)

8. Domain d4igjb1: 4igj B:1-85 [223167]
   Other proteins in same PDB: d4igja2, d4igja3, d4igjb2, d4igjb3
   automated match to d1e6ba2
   complexed with so4

Details for d4igjb1

PDB Entry: 4igj, 1.48 Å

PDB Description: Crystal structure of Maleylacetoacetate isomerase from Anaeromyxobacter dehalogenans 2CP-1, target EFI-507175

PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4igjb1:

Sequence, based on SEQRES records:

>d4igjb1 c.47.1.0 (B:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve
edgrthllvqsmailewleerhpep

Sequence, based on observed residues (ATOM records):

>d4igjb1 c.47.1.0 (B:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqqvpvleveedgrth
llvqsmailewleerhpep

Timeline for d4igjb1:

• d4igjb1 first appeared in SCOPe 2.03
  
• d4igjb1 appears in SCOPe 2.07