SCOPe 2.03: Domain d4igja2: 4igj A:86-220

Lineage for d4igja2 (4igj A:86-220)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)

8. Domain d4igja2: 4igj A:86-220 [223166]
   Other proteins in same PDB: d4igja1, d4igjb1
   automated match to d1e6ba1
   complexed with so4

Details for d4igja2

PDB Entry: 4igj, 1.48 Å

PDB Description: Crystal structure of Maleylacetoacetate isomerase from Anaeromyxobacter dehalogenans 2CP-1, target EFI-507175

PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4igja2:

Sequence; same for both SEQRES and ATOM records:

>d4igja2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapppdrrtp

Timeline for d4igja2:

• d4igja2 is new in SCOPe 2.03-stable
  
• d4igja2 appears in SCOPe 2.04
  
• d4igja2 appears in the current release, SCOPe 2.08