Lineage for d4igja2 (4igj A:86-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713811Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)
  8. 2713812Domain d4igja2: 4igj A:86-220 [223166]
    Other proteins in same PDB: d4igja1, d4igja3, d4igjb1, d4igjb3
    automated match to d1e6ba1
    complexed with so4

Details for d4igja2

PDB Entry: 4igj (more details), 1.48 Å

PDB Description: Crystal structure of Maleylacetoacetate isomerase from Anaeromyxobacter dehalogenans 2CP-1, target EFI-507175
PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4igja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4igja2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapppdrrtp

SCOPe Domain Coordinates for d4igja2:

Click to download the PDB-style file with coordinates for d4igja2.
(The format of our PDB-style files is described here.)

Timeline for d4igja2: