Lineage for d4igja1 (4igj A:1-85)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2486946Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries)
  8. 2486949Domain d4igja1: 4igj A:1-85 [223165]
    Other proteins in same PDB: d4igja2, d4igja3, d4igjb2, d4igjb3
    automated match to d1e6ba2
    complexed with so4

Details for d4igja1

PDB Entry: 4igj (more details), 1.48 Å

PDB Description: Crystal structure of Maleylacetoacetate isomerase from Anaeromyxobacter dehalogenans 2CP-1, target EFI-507175
PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4igja1:

Sequence, based on SEQRES records: (download)

>d4igja1 c.47.1.0 (A:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve
edgrthllvqsmailewleerhpep

Sequence, based on observed residues (ATOM records): (download)

>d4igja1 c.47.1.0 (A:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqvpvleveerthllvqsma
ilewleerhpep

SCOPe Domain Coordinates for d4igja1:

Click to download the PDB-style file with coordinates for d4igja1.
(The format of our PDB-style files is described here.)

Timeline for d4igja1: