Lineage for d4ig8a1 (4ig8 A:3-201)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686326Family d.218.1.6: 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain [102937] (1 protein)
    similar overall structure to the first two domains of poly(A) polymerase, PAP
  6. 1686327Protein 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain [102938] (2 species)
  7. 1686328Species Human (Homo sapiens) [TaxId:9606] [254760] (1 PDB entry)
  8. 1686329Domain d4ig8a1: 4ig8 A:3-201 [223162]
    Other proteins in same PDB: d4ig8a2
    automated match to d1px5a2
    protein/RNA complex; complexed with dtp, mg

Details for d4ig8a1

PDB Entry: 4ig8 (more details), 2.7 Å

PDB Description: Structural basis for cytosolic double-stranded RNA surveillance by human OAS1
PDB Compounds: (A:) 2'-5'-oligoadenylate synthase 1

SCOPe Domain Sequences for d4ig8a1:

Sequence, based on SEQRES records: (download)

>d4ig8a1 d.218.1.6 (A:3-201) 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dlrntpaksldkfiedyllpdtcfrmqinhaidiicgflkercfrgssypvcvskvvkgg
ssgkgttlrgrsdadlvvflsplttfqdqlnrrgefiqeirrqleacqrerafsvkfevq
aprwgnpralsfvlsslqlgegvefdvlpafdalgqltggykpnpqiyvklieectdlqk
egefstcftelqrdflkqr

Sequence, based on observed residues (ATOM records): (download)

>d4ig8a1 d.218.1.6 (A:3-201) 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dlrntpaksldkfiedyllpdtcfrmqinhaidiicgflkercfrgssypvcvskvvkgg
ssgkgttlrgrsdadlvvflsplttfqdqlnrrgefiqeirrqleacqrerafsvkfegn
pralsfvlsslqlgegvefdvlpafdalgqltggykpnpqiyvklieectdlqkegefst
cftelqrdflkqr

SCOPe Domain Coordinates for d4ig8a1:

Click to download the PDB-style file with coordinates for d4ig8a1.
(The format of our PDB-style files is described here.)

Timeline for d4ig8a1: