SCOPe 2.06: Domain d1e42a1: 1e42 A:705-824

Lineage for d1e42a1 (1e42 A:705-824)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
   ear domain consists of two different subdomains
   automatically mapped to Pfam PF02883

6. Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries)

8. Domain d1e42a1: 1e42 A:705-824 [22316]
   Other proteins in same PDB: d1e42a2, d1e42b2
   complexed with cl, dtd, gol, mg, ni

Details for d1e42a1

PDB Entry: 1e42, 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2

PDB Compounds: (A:) ap-2 complex subunit beta

SCOPe Domain Sequences for d1e42a1:

Sequence; same for both SEQRES and ATOM records:

>d1e42a1 b.1.10.1 (A:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv

Timeline for d1e42a1:

• d1e42a1 first appeared (with stable ids) in SCOP 1.55
  
• d1e42a1 appears in SCOPe 2.05
  
• d1e42a1 appears in SCOPe 2.07
  
• d1e42a1 appears in the current release, SCOPe 2.08