Lineage for d4ifya2 (4ify A:430-554)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374757Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1374758Protein automated matches [190396] (20 species)
    not a true protein
  7. 1374835Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (14 PDB entries)
  8. 1374843Domain d4ifya2: 4ify A:430-554 [223153]
    Other proteins in same PDB: d4ifya1, d4ifyb_
    automated match to d1bqna1
    protein/DNA complex; protein/RNA complex; complexed with 1fd, dms, mg, t27

Details for d4ifya2

PDB Entry: 4ify (more details), 2.1 Å

PDB Description: hiv-1 reverse transcriptase with bound fragment at the knuckles site
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d4ifya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ifya2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d4ifya2:

Click to download the PDB-style file with coordinates for d4ifya2.
(The format of our PDB-style files is described here.)

Timeline for d4ifya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ifya1
View in 3D
Domains from other chains:
(mouse over for more information)
d4ifyb_