Lineage for d4ieff2 (4ief F:580-660)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766502Species Porphyromonas gingivalis [TaxId:242619] [226635] (1 PDB entry)
  8. 2766505Domain d4ieff2: 4ief F:580-660 [223145]
    Other proteins in same PDB: d4iefb1, d4iefb3, d4iefd1, d4iefd3, d4ieff1, d4ieff3, d4iefh1, d4iefh3
    automated match to d1cvra1
    complexed with ba, ca, cl, gol, mg, na, trs

Details for d4ieff2

PDB Entry: 4ief (more details), 2.3 Å

PDB Description: complex of porphyromonas gingivalis rgpb pro- and mature domains
PDB Compounds: (F:) Gingipain R2 Mature Domain

SCOPe Domain Sequences for d4ieff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ieff2 b.1.18.0 (F:580-660) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
ptkmqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkv

SCOPe Domain Coordinates for d4ieff2:

Click to download the PDB-style file with coordinates for d4ieff2.
(The format of our PDB-style files is described here.)

Timeline for d4ieff2: