| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (43 species) not a true protein |
| Species Porphyromonas gingivalis [TaxId:242619] [226635] (1 PDB entry) |
| Domain d4iefd2: 4ief D:580-661 [223143] Other proteins in same PDB: d4iefb1, d4iefd1, d4ieff1, d4iefh1 automated match to d1cvra1 complexed with ba, ca, cl, gol, mg, na, trs |
PDB Entry: 4ief (more details), 2.3 Å
SCOPe Domain Sequences for d4iefd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iefd2 b.1.18.0 (D:580-661) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
ptkmqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkve
Timeline for d4iefd2: