Lineage for d4iefd1 (4ief D:238-579)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837112Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 1837113Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 1837274Family c.17.1.2: Gingipain R (RgpB), N-terminal domain [52137] (2 proteins)
    contains extra N-terminal alpha/beta subdomain
    automatically mapped to Pfam PF01364
  6. 1837278Protein automated matches [227116] (1 species)
    not a true protein
  7. 1837279Species Porphyromonas gingivalis [TaxId:242619] [226634] (1 PDB entry)
  8. 1837281Domain d4iefd1: 4ief D:238-579 [223142]
    Other proteins in same PDB: d4iefb2, d4iefd2, d4ieff2, d4iefh2
    automated match to d1cvra2
    complexed with ba, ca, cl, gol, mg, na, trs

Details for d4iefd1

PDB Entry: 4ief (more details), 2.3 Å

PDB Description: complex of porphyromonas gingivalis rgpb pro- and mature domains
PDB Compounds: (D:) Gingipain R2 Mature Domain

SCOPe Domain Sequences for d4iefd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iefd1 c.17.1.2 (D:238-579) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
ngrmivivpkkyeediedfvdwknqrglrtevkvaediaspvtanaiqqfvkqeyekegn
dltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfsceskedlktqidrt
ihyernittedkwlgqalciasaeggpsadngesdiqheniianlltqygytkiikcydp
gvtpkniidafnggislanytghgsetawgtshfgtthvkqltnsnqlpfifdvacvngd
flynvpcfaealmraqkdgkptgtvaiiastinqswaspmrgqdemneilcekhpnnikr
tfggvtmngmfamvekykkdgekmldtwtvfgdpsllvrtlv

SCOPe Domain Coordinates for d4iefd1:

Click to download the PDB-style file with coordinates for d4iefd1.
(The format of our PDB-style files is described here.)

Timeline for d4iefd1: