Lineage for d4iefb1 (4ief B:239-579)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463073Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2463074Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2463241Family c.17.1.2: Gingipain R (RgpB), N-terminal domain [52137] (2 proteins)
    contains extra N-terminal alpha/beta subdomain
    automatically mapped to Pfam PF01364
  6. 2463245Protein automated matches [227116] (1 species)
    not a true protein
  7. 2463246Species Porphyromonas gingivalis [TaxId:242619] [226634] (1 PDB entry)
  8. 2463247Domain d4iefb1: 4ief B:239-579 [223140]
    Other proteins in same PDB: d4iefb2, d4iefb3, d4iefd2, d4iefd3, d4ieff2, d4ieff3, d4iefh2, d4iefh3
    automated match to d1cvra2
    complexed with ba, ca, cl, gol, mg, na, trs

Details for d4iefb1

PDB Entry: 4ief (more details), 2.3 Å

PDB Description: complex of porphyromonas gingivalis rgpb pro- and mature domains
PDB Compounds: (B:) Gingipain R2 Mature Domain

SCOPe Domain Sequences for d4iefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iefb1 c.17.1.2 (B:239-579) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
grmivivpkkyeediedfvdwknqrglrtevkvaediaspvtanaiqqfvkqeyekegnd
ltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfsceskedlktqidrti
hyernittedkwlgqalciasaeggpsadngesdiqheniianlltqygytkiikcydpg
vtpkniidafnggislanytghgsetawgtshfgtthvkqltnsnqlpfifdvacvngdf
lynvpcfaealmraqkdgkptgtvaiiastinqswaspmrgqdemneilcekhpnnikrt
fggvtmngmfamvekykkdgekmldtwtvfgdpsllvrtlv

SCOPe Domain Coordinates for d4iefb1:

Click to download the PDB-style file with coordinates for d4iefb1.
(The format of our PDB-style files is described here.)

Timeline for d4iefb1: