Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.2: Gingipain R (RgpB), N-terminal domain [52137] (2 proteins) contains extra N-terminal alpha/beta subdomain automatically mapped to Pfam PF01364 |
Protein automated matches [227116] (1 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:242619] [226634] (1 PDB entry) |
Domain d4iefb1: 4ief B:239-579 [223140] Other proteins in same PDB: d4iefb2, d4iefb3, d4iefd2, d4iefd3, d4ieff2, d4ieff3, d4iefh2, d4iefh3 automated match to d1cvra2 complexed with ba, ca, cl, gol, mg, na, trs |
PDB Entry: 4ief (more details), 2.3 Å
SCOPe Domain Sequences for d4iefb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iefb1 c.17.1.2 (B:239-579) automated matches {Porphyromonas gingivalis [TaxId: 242619]} grmivivpkkyeediedfvdwknqrglrtevkvaediaspvtanaiqqfvkqeyekegnd ltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfsceskedlktqidrti hyernittedkwlgqalciasaeggpsadngesdiqheniianlltqygytkiikcydpg vtpkniidafnggislanytghgsetawgtshfgtthvkqltnsnqlpfifdvacvngdf lynvpcfaealmraqkdgkptgtvaiiastinqswaspmrgqdemneilcekhpnnikrt fggvtmngmfamvekykkdgekmldtwtvfgdpsllvrtlv
Timeline for d4iefb1: