SCOPe 2.08: Domain d1qtpa1: 1qtp A:692-824

Lineage for d1qtpa1 (1qtp A:692-824)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
   ear domain consists of two different subdomains
   automatically mapped to Pfam PF02883

6. Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries)
   Uniprot P17427 694-938 # 98% sequence identity

8. Domain d1qtpa1: 1qtp A:692-824 [22314]
   Other proteins in same PDB: d1qtpa2

Details for d1qtpa1

PDB Entry: 1qtp, 1.6 Å

PDB Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage

PDB Compounds: (A:) ap-2 clathrin adaptor alpha subunit (alpha-adaptin c)

SCOPe Domain Sequences for d1qtpa1:

Sequence; same for both SEQRES and ATOM records:

>d1qtpa1 b.1.10.1 (A:692-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnk

Timeline for d1qtpa1:

• d1qtpa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qtpa1 appears in SCOPe 2.07