Lineage for d4id5a2 (4id5 A:430-554)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887412Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)
  8. 2887420Domain d4id5a2: 4id5 A:430-554 [223126]
    Other proteins in same PDB: d4id5a1, d4id5a3, d4id5b_
    automated match to d1bqna1
    protein/DNA complex; protein/RNA complex; complexed with 1ff, dms, mg, t27

Details for d4id5a2

PDB Entry: 4id5 (more details), 1.95 Å

PDB Description: hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d4id5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4id5a2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d4id5a2:

Click to download the PDB-style file with coordinates for d4id5a2.
(The format of our PDB-style files is described here.)

Timeline for d4id5a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d4id5b_