SCOPe 2.05: Domain d4id5a1: 4id5 A:-1-429

Lineage for d4id5a1 (4id5 A:-1-429)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (5 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [226272] (12 PDB entries)

8. Domain d4id5a1: 4id5 A:-1-429 [223125]
   Other proteins in same PDB: d4id5a2
   automated match to d1bqna2
   protein/DNA complex; protein/RNA complex; complexed with 1ff, dms, mg, t27

Details for d4id5a1

PDB Entry: 4id5, 1.95 Å

PDB Description: hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d4id5a1:

Sequence; same for both SEQRES and ATOM records:

>d4id5a1 e.8.1.2 (A:-1-429) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdi
viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
tpplvklwyql

Timeline for d4id5a1:

• d4id5a1 first appeared in SCOPe 2.03
  
• d4id5a1 appears in SCOPe 2.04
  
• d4id5a1 appears in SCOPe 2.06
  
• d4id5a1 appears in the current release, SCOPe 2.08