SCOPe 2.03: Domain d4ibya_: 4iby A:

Lineage for d4ibya_ (4iby A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (32 PDB entries)

8. Domain d4ibya_: 4iby A: [223116]
   automated match to d2ahia_
   complexed with edo, zn; mutant

Details for d4ibya_

PDB Entry: 4iby, 1.45 Å

PDB Description: human p53 core domain with hot spot mutation r273h and second-site suppressor mutation s240r

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4ibya_:

Sequence; same for both SEQRES and ATOM records:

>d4ibya_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
hsvvvpyeppevgsdcttihynymcnrscmggmnrrpiltiitledssgnllgrnsfevh
vcacpgrdrrteeenlr

Timeline for d4ibya_:

• d4ibya_ is new in SCOPe 2.03-stable
  
• d4ibya_ appears in SCOPe 2.04
  
• d4ibya_ appears in the current release, SCOPe 2.08