| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
| Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries) |
| Domain d4ibud_: 4ibu D: [223113] automated match to d2ahia_ protein/DNA complex; complexed with act, edo, zn; mutant |
PDB Entry: 4ibu (more details), 1.7 Å
SCOPe Domain Sequences for d4ibud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ibud_ b.2.5.2 (D:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevcv
cacpgrdrrreeenlr
Timeline for d4ibud_: