SCOPe 2.07: Domain d1d7da_: 1d7d A:

Lineage for d1d7da_ (1d7d A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.9: CBD9-like [49344] (4 families)
   has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site

5. Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein)

6. Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species)

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (4 PDB entries)

8. Domain d1d7da_: 1d7d A: [22311]
   complexed with 1pg, cd, hem

Details for d1d7da_

PDB Entry: 1d7d, 1.9 Å

PDB Description: cytochrome domain of cellobiose dehydrogenase, hp3 fragment, ph 7.5

PDB Compounds: (A:) cellobiose dehydrogenase

SCOPe Domain Sequences for d1d7da_:

Sequence; same for both SEQRES and ATOM records:

>d1d7da_ b.1.9.1 (A:) Cytochrome domain of cellobiose dehydrogenase {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
yqnyln

Timeline for d1d7da_:

• d1d7da_ first appeared (with stable ids) in SCOP 1.55
  
• d1d7da_ appears in SCOPe 2.06
  
• d1d7da_ appears in the current release, SCOPe 2.08