Lineage for d4ibsc_ (4ibs C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525684Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1525685Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1525686Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 1525687Species Human (Homo sapiens) [TaxId:9606] [49420] (34 PDB entries)
  8. 1525724Domain d4ibsc_: 4ibs C: [223104]
    automated match to d2ahia_
    complexed with edo, zn; mutant

Details for d4ibsc_

PDB Entry: 4ibs (more details), 1.78 Å

PDB Description: human p53 core domain with hot spot mutation r273h (form i)
PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4ibsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibsc_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevhvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d4ibsc_:

Click to download the PDB-style file with coordinates for d4ibsc_.
(The format of our PDB-style files is described here.)

Timeline for d4ibsc_: