Lineage for d4ibob_ (4ibo B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1349995Species Agrobacterium fabrum [TaxId:176299] [226548] (2 PDB entries)
  8. 1349997Domain d4ibob_: 4ibo B: [223095]
    automated match to d2rhcb_
    complexed with cl, mg

Details for d4ibob_

PDB Entry: 4ibo (more details), 2.1 Å

PDB Description: Crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target EFI-506446)
PDB Compounds: (B:) Gluconate dehydrogenase

SCOPe Domain Sequences for d4ibob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibob_ c.2.1.0 (B:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
qiifdlggrtalvtgssrglgramaeglavagarilingtdpsrvaqtvqefrnvghdae
avafdvtseseiieafarldeqgidvdilvnnagiqfrkpmieletadwqrvidtnltsa
fmigreaakrmiprgygkivnigsltselaratvapytvakggikmltramaaewaqygi
qanaigpgymltdmnqalidnpefdawvkartpakrwgkpqelvgtavflsasasdyvng
qiiyvdggmlsvl

SCOPe Domain Coordinates for d4ibob_:

Click to download the PDB-style file with coordinates for d4ibob_.
(The format of our PDB-style files is described here.)

Timeline for d4ibob_: